Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GALNT12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$254.42 - $728.30
Specifications
| Antigen | GALNT12 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
GALNT12 Polyclonal specifically detects GALNT12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GALNT12 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| colorectal cancer, susceptibility to 1, CRCS1, EC 2.4.1.41, FLJ21212, GalNAc-T12, Polypeptide GalNAc transferase 12, polypeptide N-acetylgalactosaminyltransferase 12, pp-GaNTase 12, Protein-UDP acetylgalactosaminyltransferase 12, UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12) | |
| GALNT12 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 79695 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title