Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GALNT5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309230100UL
Description
GALNT5 Polyclonal specifically detects GALNT5 in Human samples. It is validated for Western Blot.Specifications
| GALNT5 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| EC 2.4.1.41, GALNAC-T5, MGC165041, Polypeptide GalNAc transferase 5, polypeptide N-acetylgalactosaminyltransferase 5, pp-GaNTase 5, Protein-UDP acetylgalactosaminyltransferase 5, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 5 (GalNAc-T5) | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of human GALNT5 (NP_055383.1). Peptide sequence RDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIEDTR | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 11227 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction