GALNTL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397575	Novus Biologicals NBP23174725UL	25 μL
NBP231747	Novus Biologicals NBP231747	0.1 mL

Description

GALNTL1 Polyclonal specifically detects GALNTL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GALNTL1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.4.1.41, GalNAc-T-like protein 1, GALNT16, KIAA1130GALNACT16, MGC141855, Polypeptide GalNAc transferase-like protein 1, polypeptide N-acetylgalactosaminyltransferase 16, pp-GaNTase-like protein 1, Protein-UDP acetylgalactosaminyltransferase-like protein 1, putative polypeptide N-acetylgalactosaminyltransferase-like protein 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 1
• Gene Symbols: GALNT16
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q8N428
• Gene ID (Entrez): 57452
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQADAQAQQWQLLPH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only