Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
gamma-2 Tubulin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | gamma-2 Tubulin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
gamma-2 Tubulin Polyclonal specifically detects gamma-2 Tubulin in Human samples. It is validated for Western Blot.Specifications
gamma-2 Tubulin | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
gamma-2-tubulin, MGC131994, tubulin gamma-2 chain, tubulin, gamma 2 | |
TUBG2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9NRH3 | |
27175 | |
Synthetic peptides corresponding to TUBG2 (tubulin, gamma 2) The peptide sequence was selected from the middle region of TUBG2. Peptide sequence FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title