Learn More
Description
Specifications
Specifications
| Gene ID (Entrez) | 2596 |
| Protein Length | SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | GAP43 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | Axonal membrane protein GAP-43, B-50, Basp2, calmodulin-binding protein P-57, GAP43, GAP-43, growth associated protein 43, Growth-associated protein 43 |
| Gene Symbol | GAP43 |
| Label Type | Unlabeled |
| Show More |
For Research Use Only.
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
