Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GAPDH Antibody, Novus Biologicals™

GAPDH Antibody, Novus Biologicals™
SDP

Catalog No. NB396018 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396018 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396018 Supplier Novus Biologicals Supplier No. NBP24872125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

GAPDH Polyclonal antibody specifically detects GAPDH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen GAPDH
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH
Host Species Rabbit
Immunogen This GAPDH antibody was developed against a recombinant protein corresponding to amino acids: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Alzheimers Research, Apoptosis, Autophagy, Cancer, DNA Repair, Lipid and Metabolism, Loading Controls, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Nuclear Receptors Coactivators and Corepressors, Signal Transduction, Translation Control
Primary or Secondary Primary
Gene ID (Entrez) 2597
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.