Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GAR1 Rabbit anti-Human, Polyclonal , Abnova™

GAR1 polyclonal antibody raised against recombinant human GAR1.

Manufacturer:  Abnova Corporation PAB29476

Catalog No. 89-934-188


Add to cart

Description

Description

This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq]

Sequence: GRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTT
Specifications

Specifications

GAR1
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:500-1:1000) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Liquid
GAR1
Recombinant protein corresponding to amino acids of human GAR1.
Antigen affinity purification
RUO
Primary
54433
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
GAR1 polyclonal antibody raised against recombinant human GAR1.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
NOLA1
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit