Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GAS8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GAS8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GAS8 Polyclonal specifically detects GAS8 in Human samples. It is validated for Western Blot.Specifications
GAS8 | |
Polyclonal | |
Rabbit | |
O95995 | |
2622 | |
Synthetic peptides corresponding to GAS8 (growth arrest-specific 8) The peptide sequence was selected from the N terminal of GAS8. Peptide sequence VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
GAS-11, GAS11MGC138326, GAS-8, growth arrest specific 11, growth arrest-specific 11, growth arrest-specific 8, Growth arrest-specific protein 11, growth arrest-specific protein 8 | |
GAS8 | |
IgG | |
56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title