Gastric Lipase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP191928

Catalog No. NBP191928

Description

Gastric Lipase Polyclonal specifically detects Gastric Lipase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Gastric Lipase
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: EC 3.1.1, EC 3.1.1.3, Gastric lipase, gastric triacylglycerol lipase, GL, HGL, HLAL, lipase, gastric, MGC138477, MGC142271
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: LIPF
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDK
• Quantity: 0.1 mL
• Research Discipline: Autophagy, Cholesterol Metabolism, Chromatin Research, Diabetes Research, Endothelial Cell Markers, Glia Markers, Growth and Development, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience, Oligodendrocyte Cell Markers, Signal Transduction
• Gene ID (Entrez): 8513
• Target Species: Human
• Isotype: IgG

For Research Use Only