Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GATA-6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310916100UL
Description
GATA-6 Polyclonal specifically detects GATA-6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
GATA-6 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
GATA binding protein 6, GATA-binding factor 6, GATA-binding protein 6, transcription factor GATA-6 | |
The immunogen is a synthetic peptide directed towards the middle region of human GATA-6 (NP_005248). Peptide sequence SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS | |
100 μg | |
Phospho Specific, Stem Cell Markers | |
2627 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunofluorescence | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction