GATE-16/GABARAPL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP188883

Catalog No. NBP188883

Description

GATE-16/GABARAPL2 Polyclonal specifically detects GATE-16/GABARAPL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GATE-16/GABARAPL2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ATG8, ATG8C, FLC3A, gamma-aminobutyric acid receptor-associated protein-like 2, Ganglioside expression factor 2, GATE16, GATE-16, GEF2, GEF-2, GEF2GEF-2, General Protein Transport Factor P16, Golgi-Associated ATPase Enhancer Of 16 KDa, MAP1 light chain 3 related protein, MAP1 light chain 3-related protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11345
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GABARAPL2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only