Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GBE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$405.00 - $670.00
Specifications
Antigen | GBE1 |
---|---|
Concentration | 0.1mg/mL |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Description
GBE1 Polyclonal specifically detects GBE1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GBE1 | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human, Rat | |
1,4-alpha-glucan-branching enzyme, amylo-(1,4 to 1,6) transglucosidase, amylo-(1,4 to 1,6) transglycosylase, Brancher enzyme, EC 2.4.1.18, GBE, glucan (1,4-alpha), branching enzyme 1, glycogen branching enzyme, Glycogen-branching enzyme | |
GBE1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
0.1mg/mL | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2632 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title