GBL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324863

Catalog No. NB301589

Description

GBL Polyclonal antibody specifically detects GBL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: GBL
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: G protein beta subunit-like, Gable, GbetaL, GBLPop3, Lst8, LST8MGC111011, Mammalian lethal with SEC13 protein 8, mLST8, MTOR associated protein, LST8 homolog (S. cerevisiae), POP3, Protein GbetaL, target of rapamycin complex subunit LST8, TORC subunit LST8, WAT1
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein GBL using the following amino acid sequence: QDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLR
• Quantity: 100 μL
• Research Discipline: Cancer, Hypoxia, mTOR Pathway
• Gene ID (Entrez): 64223
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified