Learn More
Description
Specifications
Specifications
| Antigen | GBL |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | G protein beta subunit-like, Gable, GbetaL, GBLPop3, Lst8, LST8MGC111011, Mammalian lethal with SEC13 protein 8, mLST8, MTOR associated protein, LST8 homolog (S. cerevisiae), POP3, Protein GbetaL, target of rapamycin complex subunit LST8, TORC subunit LST8, WAT1 |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein GBL using the following amino acid sequence: QDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLR |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
