Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GDF-11/BMP-11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257399
Description
GDF-11/BMP-11 Polyclonal specifically detects GDF-11/BMP-11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GDF-11/BMP-11 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
BMP-11BMP11Bone morphogenetic protein 11, GDF-11, growth differentiation factor 11, growth/differentiation factor 11 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
GDF11 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT | |
100 μL | |
Cytokine Research | |
10220 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction