Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GDF-11/BMP-11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25747425UL
Description
GDF-11/BMP-11 Polyclonal specifically detects GDF-11/BMP-11 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
GDF-11/BMP-11 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
BMP-11BMP11Bone morphogenetic protein 11, GDF-11, growth differentiation factor 11, growth/differentiation factor 11 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
GDF11 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFQGDALQPEDFLEEDEYHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKVMF | |
25 μL | |
Cytokine Research | |
10220 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction