Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GDF-9 Antibody (53/1), mFluor Violet 450 SE, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP261934MFV450
Description
GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, ImmunohistochemistrySpecifications
| GDF-9 | |
| Monoclonal | |
| mFluor Violet 450 SE | |
| 50mM Sodium Borate | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunohistochemistry | |
| 53/1 | |
| Western Blot, ELISA, Immunohistochemistry | |
| GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
| Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9 | |
| 0.1 mL | |
| Cytokine Research | |
| 2661 | |
| Store at 4C in the dark. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction