Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GFAP Antibody, Novus Biologicals™
SDP

Catalog No. NBP254748 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP254748 100 μL
NB395271 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP254748 Supplier Novus Biologicals Supplier No. NBP254748
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 1 publication

GFAP Polyclonal specifically detects GFAP in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen GFAP
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias FLJ45472, GFAP astrocytes, glial fibrillary acidic protein
Gene Symbols GFAP
Host Species Rabbit
Immunogen This GFAP antibody was developed against a Recombinant Protein corresponding to amino acids: NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
Molecular Weight of Antigen 50 kDa
Purification Method Immunogen affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Astrocyte Markers, Cancer, Cell Biology, Cellular Markers, Chaperone Mediated Autophagy (CMA), Inflammation, Neurodegeneration, Neuroscience, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2670
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.