Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ GFI1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579305
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579305 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579305 Supplier Invitrogen™ Supplier No. PA579305
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: human mammary cancer tissue, human rectal cancer tissue.

GFI1 is a nuclear zinc finger (ZF) transcriptional repressor that plays an important role in hematopoiesis and inner ear development, and has been implicated in lymphomagenesis. The Gfi1 protein expression is regulated by the ubiquitin-proteasome system. It is reported that ubiquitin ligase Triad1 interacts with the DNA-binding domain of Gfi-1. Gfi-1 represses transcription by directly binding to the consensus DNA sequence in the promoters of its target genes. Deficiency of Gfi-1 causes neutropenia and an accumulation of granulomonocytic precursor cells that is reminiscent of a myelodysplastic syndrome in mice.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GFI1
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene GFI1
Gene Accession No. P70338, Q07120, Q99684
Gene Alias AW495828; FLJ94509; Gfi1; GFI-1; GFI1A; growth factor independence-1; growth factor independent 1; growth factor independent 1 transcription repressor; growth factor independent 1 transcriptional repressor; growth factor independent protein 1; Growth factor independent-1; Pal1; Pal-1; SCN2; Zinc finger protein 163; zinc finger protein Gfi-1; ZNF163
Gene Symbols GFI1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 14581, 24388, 2672
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.