GFR alpha-3/GDNF R alpha-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB405795	Novus Biologicals NBP18977425UL	25 μL
NBP189774	Novus Biologicals NBP189774	0.1 mL

Description

GFR alpha-3/GDNF R alpha-3 Polyclonal specifically detects GFR alpha-3/GDNF R alpha-3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GFR alpha-3/GDNF R alpha-3
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: O60609
• Gene ID (Entrez): 2676
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 44 kDa

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500-1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cytokine Research, Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: GDNF family receptor alpha 3, GDNF family receptor alpha-3, GDNF receptor alpha-3, GDNFR-alpha-3, GFRa-3, GFR-alpha-3, glial cell line-derived neurotrophic factor receptor alpha-3, GPI-linked receptor
• Gene Symbols: GFRA3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only