Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GID4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | C17orf39 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GID4 Polyclonal specifically detects GID4 in Human samples. It is validated for Western Blot.Specifications
C17orf39 | |
Polyclonal | |
Rabbit | |
Q8IVV7 | |
79018 | |
Synthetic peptides corresponding to C17ORF39 The peptide sequence was selected from the C terminal of C17ORF39. Peptide sequence SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C17orf39, chromosome 17 open reading frame 39, GID complex subunit 4, VID24 homolog (S. cerevisiae), hypothetical protein LOC79018, MGC3048, VID24 | |
GID4 | |
IgG | |
33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title