GilZ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255645

Catalog No. NBP255645

Description

GilZ Polyclonal specifically detects GilZ in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GilZ
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive leucine zipper protein, DSIP-immunoreactive peptide, GILZDKFZp313A1123, Glucocorticoid-induced leucine zipper protein, Protein DIP, TSC22 domain family protein 3, TSC22 domain family, member 3, TSC-22 related protein, TSC-22-like protein, TSC-22-related protein, TSC-22Rimmunoreactor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TSC22D3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 1831
• Target Species: Human
• Isotype: IgG

For Research Use Only