GIPC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155244

Catalog No. NBP155244

Description

GIPC2 Polyclonal specifically detects GIPC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GIPC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ20075, GIPC PDZ domain containing family, member 2, PDZ domain protein GIPC2, PDZ domain-containing protein GIPC2, semaF cytoplasmic domain associated protein 2, semaphorin cytoplasmic domain associated protein 2, SEMCAP2, SEMCAP-2
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 54810
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q8TF65
• Gene Symbols: GIPC2
• Immunogen: Synthetic peptides corresponding to GIPC2 (GIPC PDZ domain containing family, member 2) The peptide sequence was selected from the N terminal of GIPC2. Peptide sequence MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only