Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GIPC2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155244 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155244 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155244 Supplier Novus Biologicals Supplier No. NBP155244
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

GIPC2 Polyclonal specifically detects GIPC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen GIPC2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TF65
Gene Alias FLJ20075, GIPC PDZ domain containing family, member 2, PDZ domain protein GIPC2, PDZ domain-containing protein GIPC2, semaF cytoplasmic domain associated protein 2, semaphorin cytoplasmic domain associated protein 2, SEMCAP2, SEMCAP-2
Gene Symbols GIPC2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GIPC2 (GIPC PDZ domain containing family, member 2) The peptide sequence was selected from the N terminal of GIPC2. Peptide sequence MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH.
Molecular Weight of Antigen 35 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 54810
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.