GJC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159263

Catalog No. NBP159263

Description

GJC2 Polyclonal specifically detects GJC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GJC2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: connexin46.6, connexin-46.6, Connexin-47, CX46.6, CX47, Gap junction alpha-12 protein, gap junction gamma-2 protein, gap junction protein, alpha 12, 47kDa, gap junction protein, gamma 2, 47kDa, GJA12connexin 47, HLD2, LMPH1C, PMLDAR, SPG44MGC105119
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:100, Immunohistochemistry-Paraffin
• Gene Accession No.: Q5T442
• Gene Symbols: GJC2
• Immunogen: Synthetic peptides corresponding to GJC2(gap junction protein, gamma 2, 47kDa) The peptide sequence was selected from the middle region of GJC2. Peptide sequence APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57165
• Target Species: Human, Rabbit
• Isotype: IgG

For Research Use Only