GK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156691

Catalog No. NBP156691

Description

GK2 Polyclonal specifically detects GK2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GK2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.1.30, GK 2, GKP2, GKTAATP:glycerol 3-phosphotransferase 2, Glycerokinase 2, glycerol kinase 2, glycerol kinase pseudogene 2, glycerol kinase testis specific 2, Glycerol kinase, testis specific 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2712
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q01415
• Gene Symbols: GK2
• Immunogen: Synthetic peptides corresponding to GK2(glycerol kinase 2) The peptide sequence was selected from the C terminal of GK2. Peptide sequence QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Crab-eating macaque: 92%; Rat: 84%; Mouse: 84%;.
• Target Species: Human, Mouse, Equine, Guinea Pig, Rabbit
• Isotype: IgG