Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLS2 Rabbit anti-Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish, DyLight 488, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154773G
Description
GLS2 Polyclonal specifically detects GLS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GLS2 | |
Polyclonal | |
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin | |
EC 3.5.1.2, GAbreast cell glutaminase, GLSglutaminase GA, glutaminase 2 (liver, mitochondrial), glutaminase I, glutaminase liver isoform, mitochondrial, hLGA, LGA, L-glutaminase, L-glutamine amidohydrolase, MGC71567, phosphate-activated glutaminase, phosphate-dependent glutaminase, truncated glutaminase 2 | |
Rabbit | |
Protein A purified | |
RUO | |
27165 | |
Store at 4C in the dark. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
DyLight 488 | |
50mM Sodium Borate with 0.05% Sodium Azide | |
GLS2 | |
Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. | |
100 μL | |
Primary | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
RUO
Spot an opportunity for improvement?Share a Content Correction