GLT6D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179310

Catalog No. NBP179310

Description

GLT6D1 Polyclonal specifically detects GLT6D1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GLT6D1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: galactosyltransferase family 6 domain containing 1, galactosyltransferase family 6 domain-containing 1, glycosyltransferase 6 domain containing 1, glycosyltransferase 6 domain-containing protein 1, GT6M7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 360203
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_892019
• Gene Symbols: GLT6D1
• Immunogen: Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Pig: 85%.
• Target Species: Human, Rat, Pig, Bovine, Equine
• Isotype: IgG