Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GLT6D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17931020UL
Description
GLT6D1 Polyclonal specifically detects GLT6D1 in Human samples. It is validated for Western Blot.Specifications
GLT6D1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_892019 | |
GLT6D1 | |
Synthetic peptide directed towards the middle region of human GLT6D1The immunogen for this antibody is GLT6D1. Peptide sequence FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
galactosyltransferase family 6 domain containing 1, galactosyltransferase family 6 domain-containing 1, glycosyltransferase 6 domain containing 1, glycosyltransferase 6 domain-containing protein 1, GT6M7 | |
Rabbit | |
Affinity Purified | |
RUO | |
360203 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction