Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Glucosamine (N-acetyl)-6-Sulfatase/GNS |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Glucosamine (N-acetyl)-6-Sulfatase/GNS Polyclonal specifically detects Glucosamine (N-acetyl)-6-Sulfatase/GNS in Rat samples. It is validated for Western Blot.Specifications
Glucosamine (N-acetyl)-6-Sulfatase/GNS | |
Polyclonal | |
Rabbit | |
Q5M918 | |
2799 | |
Synthetic peptides corresponding to Gns (glucosamine (N-acetyl)-6-sulfatase) The peptide sequence was selected from the C terminal of Gns. Peptide sequence YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 3.1.6, EC 3.1.6.14, G6Sglucosamine-6-sulfatase, glucosamine (N-acetyl)-6-sulfatase, Glucosamine-6-sulfatase, MGC21274, N-acetylglucosamine-6-sulfatase | |
GNS | |
IgG | |
58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title