Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glucose Transporter GLUT6 Antibody, mFluor Violet 610 SE, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159891MFV610
Description
Glucose Transporter GLUT6 Polyclonal antibody specifically detects Glucose Transporter GLUT6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Glucose Transporter GLUT6 | |
Polyclonal | |
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin | |
Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6 | |
Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region. | |
0.1 mL | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
mFluor Violet 610 SE | |
50mM Sodium Borate | |
Rabbit | |
Protein A purified | |
RUO | |
11182 | |
Store at 4C in the dark. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction