Glucose Transporter GLUT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159891

Catalog No. NBP159891

Description

Glucose Transporter GLUT6 Polyclonal specifically detects Glucose Transporter GLUT6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Glucose Transporter GLUT6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11182
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9UGQ3
• Gene Symbols: SLC2A6
• Immunogen: Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Form: Purified

For Research Use Only