Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glutathione Peroxidase 2/GPX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Glutathione Peroxidase 2/GPX2 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Glutathione Peroxidase 2/GPX2 Polyclonal specifically detects Glutathione Peroxidase 2/GPX2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Glutathione Peroxidase 2/GPX2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
2877 | |
This antibody was developed against a recombinant protein corresponding to amino acids: VLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
EC 1.11.1, EC 1.11.1.9, Gastrointestinal glutathione peroxidase, gastrointestinal glutathione peroxidase 2, GI-GPx, glutathione peroxidase 2, glutathione peroxidase 2 (gastrointestinal), Glutathione peroxidase-gastrointestinal, Glutathione peroxidase-related protein 2, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPx-2, GSHPx-GI | |
GPX2 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title