Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glycerol 3 Phosphate Dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Glycerol 3 Phosphate Dehydrogenase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15533220
|
Novus Biologicals
NBP15533220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155332
|
Novus Biologicals
NBP155332 |
100 μL |
Each for $487.50
|
|
|||||
Description
Glycerol 3 Phosphate Dehydrogenase Polyclonal specifically detects Glycerol 3 Phosphate Dehydrogenase in Human samples. It is validated for Western Blot.Specifications
| Glycerol 3 Phosphate Dehydrogenase | |
| Polyclonal | |
| Rabbit | |
| P21695 | |
| 2819 | |
| Synthetic peptides corresponding to GPD1(glycerol-3-phosphate dehydrogenase 1 (soluble)) The peptide sequence was selected from the middle region of GPD1. Peptide sequence TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 1.1.1, EC 1.1.1.8, FLJ26652, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic, glycerol-3-phosphate dehydrogenase 1 (soluble), glycerol-3-phosphate dehydrogenase, soluble, GPD-C, GPDH-C | |
| GPD1 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title