Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Glycogen Phosphorylase BB/GPBB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154966
Description
Glycogen Phosphorylase BB/GPBB Polyclonal specifically detects Glycogen Phosphorylase BB/GPBB in Human samples. It is validated for Western Blot.Specifications
Glycogen Phosphorylase BB/GPBB | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Brain glycogen phosphorylase, EC 2.4.1.1, Glycogen phosphorylase B, Glycogen phosphorylase brain form, Glycogen Phosphorylase Isoenzyme BB, MGC9213, Phosphorylase glycogen brain, PYGB | |
Rabbit | |
97 kDa | |
100 μL | |
Primary | |
Porcine: 86%; Guinea pig: 86%; . | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P11216 | |
PYGB | |
Synthetic peptides corresponding to PYGB(phosphorylase, glycogen; brain) The peptide sequence was selected from the N terminal of PYGB. Peptide sequence ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT. | |
Affinity purified | |
RUO | |
5834 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction