Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GlyT2/SLC6A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159657
Description
GlyT2/SLC6A5 Polyclonal specifically detects GlyT2/SLC6A5 in Human samples. It is validated for Western Blot.Specifications
GlyT2/SLC6A5 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
GlyT2, GLYT-2, GLYT2GlyT-2, NET1, sodium- and chloride-dependent glycine transporter 2, solute carrier family 6 (neurotransmitter transporter, glycine), member 5, Solute carrier family 6 member 5 | |
Rabbit | |
87 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9Y345 | |
SLC6A5 | |
Synthetic peptides corresponding to SLC6A5(solute carrier family 6 (neurotransmitter transporter, glycine), member 5) The peptide sequence was selected from the middle region of SLC6A5. Peptide sequence LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
9152 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction