Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Gm13178 Antibody, Novus Biologicals™

Gm13178 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17420320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17420320 20 μL
NBP174203 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17420320 Supplier Novus Biologicals Supplier No. NBP17420320UL

Description

Rabbit Polyclonal Antibody

Gm13178 Polyclonal specifically detects Gm13178 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Gm13178
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. B1AVU7
Gene Alias hypothetical protein LOC546849, predicted gene 13178
Gene Symbols GM13178
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the C terminal of Gm13178. Immunizing peptide sequence TFLVSCEHDVLRDDALLYKKRLEDQGVPVSWYHAEDGFHGCISLFDKQPF.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 546849
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.