Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gm13178 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Gm13178 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17420320
|
Novus Biologicals
NBP17420320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174203
|
Novus Biologicals
NBP174203 |
100 μL |
Each for $487.50
|
|
|||||
Description
Gm13178 Polyclonal specifically detects Gm13178 in Mouse samples. It is validated for Western Blot.Specifications
| Gm13178 | |
| Polyclonal | |
| Rabbit | |
| B1AVU7 | |
| 546849 | |
| Synthetic peptides corresponding to the C terminal of Gm13178. Immunizing peptide sequence TFLVSCEHDVLRDDALLYKKRLEDQGVPVSWYHAEDGFHGCISLFDKQPF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hypothetical protein LOC546849, predicted gene 13178 | |
| GM13178 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title