Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Gm527 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Gm527 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Gm527 Polyclonal specifically detects Gm527 in Mouse samples. It is validated for Western Blot.Specifications
Gm527 | |
Polyclonal | |
Rabbit | |
Q4KL13 | |
217648 | |
Synthetic peptides corresponding to the C terminal of Gm527. Immunizing peptide sequence: CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
hypothetical protein LOC217648, MGC117765, predicted gene 527 | |
Gm527 | |
IgG | |
34 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title