Learn More
Invitrogen™ Gm5581 Polyclonal Antibody

Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA570367
Description
This target displays homology in the following species: Cow: 92%; Dog: 92%; Human: 100%; Pig: 92% Peptide sequence: EEWECLDSAQRDLYRDVMLENYHNLVSVGVAVSKSEVIFCLEQNNESWIA For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. Concentration is batch dependent: 0.5-1 mg/mL.
Gm5581 is a protein coding gene.
Specifications
Gm5581 | |
Polyclonal | |
Unconjugated | |
Gm5581 | |
Gm5581 | |
Synthetic peptide directed towards the middle region of mouse Gm5581. | |
100 μL | |
Primary | |
Mouse | |
Antibody | |
IgG |
Western Blot | |
0.5-1.0 mg/mL | |
PBS with 2% sucrose and 0.09% sodium azide | |
0 | |
Rabbit | |
Affinity Chromatography | |
RUO | |
434094 | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
Safety and Handling
Your input is important to us. Please complete this form to provide feedback related to the content on this product.