Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GMPS Antibody, Novus Biologicals™
SDP

Catalog No. p-7106278 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152972 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152972 Supplier Novus Biologicals Supplier No. NBP152972
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.

Specifications

Antigen GMPS
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P49915
Gene Alias EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Gene Symbols GMPS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA.
Molecular Weight of Antigen 77 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 8833
Test Specificity Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.