Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNAQ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158311
Description
GNAQ Polyclonal specifically detects GNAQ in Human samples. It is validated for Western Blot.Specifications
GNAQ | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
GAQG-ALPHA-q, guanine nucleotide binding protein (G protein), q polypeptide, Guanine nucleotide-binding protein alpha-q, guanine nucleotide-binding protein G(q) subunit alpha | |
Rabbit | |
42 kDa | |
100 μL | |
Cardiovascular Biology | |
2776 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P50148 | |
GNAQ | |
Synthetic peptides corresponding to GNAQ(guanine nucleotide binding protein (G protein), q polypeptide) The peptide sequence was selected from the N terminal of GNAQ. Peptide sequence DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK. | |
Affinity purified | |
RUO | |
Primary | |
This product is specific to Subunit or Isoform: alpha. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction