Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | GNB1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155307
![]() |
Novus Biologicals
NBP155307 |
100 μL |
Each for $487.50
|
|
|||||
NBP15530720
![]() |
Novus Biologicals
NBP15530720UL |
20 μL | N/A | N/A | N/A | ||||
Description
GNB1 Polyclonal specifically detects GNB1 in Human, Rat samples. It is validated for Western Blot.Specifications
GNB1 | |
Polyclonal | |
Rabbit | |
P62873 | |
2782 | |
Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT | |
Primary | |
37 kDa |
Western Blot | |
Unconjugated | |
RUO | |
beta subunit, signal-transducing proteins GS/GI, G protein, beta-1 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Transducin beta chain 1 | |
GNB1 | |
IgG | |
This product is specific to Subunit or Isoform: beta-1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title