Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GNB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | GNB1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155308
![]() |
Novus Biologicals
NBP155308 |
100 μL |
Each for $480.74
|
|
|||||
NBP15530820
![]() |
Novus Biologicals
NBP15530820UL |
20 μL | N/A | N/A | N/A | ||||
Description
GNB1 Polyclonal specifically detects GNB1 in Human samples. It is validated for Western Blot.Specifications
| GNB1 | |
| Polyclonal | |
| Rabbit | |
| P62873 | |
| 2782 | |
| Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the C terminal of GNB1. Peptide sequence DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD | |
| Primary | |
| 37 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| beta subunit, signal-transducing proteins GS/GI, G protein, beta-1 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Transducin beta chain 1 | |
| GNB1 | |
| IgG | |
| This product is specific to Subunit or Isoform: beta-1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title