GNB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NBP15530720	Novus Biologicals NBP15530720UL	20 μL
NBP155307	Novus Biologicals NBP155307	100 μL

Description

GNB1 Polyclonal specifically detects GNB1 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: GNB1
• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta subunit, signal-transducing proteins GS/GI, G protein, beta-1 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 1, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1, Transducin beta chain 1
• Gene Symbols: GNB1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: This product is specific to Subunit or Isoform: beta-1.

• Applications: Western Blot
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Accession No.: P62873
• Gene ID (Entrez): 2782
• Immunogen: Synthetic peptides corresponding to GNB1(guanine nucleotide binding protein (G protein), beta polypeptide 1) The peptide sequence was selected from the N terminal of GNB1. Peptide sequence MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 37 kDa