Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GNB2 Antibody, Novus Biologicals™

GNB2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15532320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15532320 20 μL
NBP155323 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15532320 Supplier Novus Biologicals Supplier No. NBP15532320UL

Description

Rabbit Polyclonal Antibody

GNB2 Polyclonal specifically detects GNB2 in Human samples. It is validated for Western Blot.

Specifications

Antigen GNB2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P62879
Gene Alias beta-2 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2, guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2, signal-transducing guanine nucleotide-binding regulatory protein beta subunit
Gene Symbols GNB2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GNB2(guanine nucleotide binding protein (G protein), beta polypeptide 2) The peptide sequence was selected from the middle region of GNB2. Peptide sequence CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAP
Molecular Weight of Antigen 37 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2783
Test Specificity This product is specific to Subunit or Isoform: beta-2.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.