Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GOAT/MBOAT4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | GOAT/MBOAT4 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GOAT/MBOAT4 Polyclonal specifically detects GOAT/MBOAT4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
GOAT/MBOAT4 | |
Polyclonal | |
Rabbit | |
Human | |
619373 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
EC 2.3.1.-, ghrelin O-acyltransferase, GOATFKSG89, membrane bound O-acyltransferase domain containing 4, Membrane-bound O-acyltransferase domain-containing protein 4, OACT4, O-acyltransferase (membrane bound) domain containing 4, O-acyltransferase domain-containing protein 4 | |
MBOAT4 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title