Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GOLGA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	GOLGA6
Dilution	Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP254716 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP254716	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB395286 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25471625UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GOLGA6 Polyclonal specifically detects GOLGA6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	GOLGA6
Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	342096
Immunogen	This antibody was developed against a Recombinant Protein corresponding to amino acids:GVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLA
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	FLJ75859, GLPGolgin-like protein, GOLGA6Golgin linked to PML, golgi autoantigen, golgin subfamily a, 6, golgi autoantigen, golgin subfamily a, 6A, golgi autoantigen, golgin subfamily a, member 6, golgin A6 family, member A, Golgin subfamily A member 6A
Gene Symbols	GOLGA6A
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GOLGA6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents