Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GOLGA7B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	GOLGA7B
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15675420 View Documents View Product Certificates	Novus Biologicals NBP15675420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP156754 View Documents View Product Certificates	Novus Biologicals NBP156754	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GOLGA7B Polyclonal specifically detects GOLGA7B in Human samples. It is validated for Western Blot.

Specifications

Antigen	GOLGA7B
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q2TAP0
Gene ID (Entrez)	401647
Immunogen	Synthetic peptides corresponding to C10ORF132 The peptide sequence was selected from the N terminal of C10ORF132. Peptide sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQ.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	bA451M19.3, bA459F3.4, C10orf132, C10orf133, chromosome 10 open reading frame 132, chromosome 10 open reading frame 133, golgi autoantigen, golgin subfamily a, 7B, golgin A7 family, member B, Golgin subfamily A member 7B, MGC131701
Gene Symbols	GOLGA7B
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GOLGA7B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents