Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Golgin 97 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179554

 View more versions of this product

Catalog No. NBP179554


Add to cart

Description

Description

Golgin 97 Polyclonal antibody specifically detects Golgin 97 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Golgin 97
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GOLGA1
Synthetic peptide directed towards the N terminal of human GOLGA1. Peptide sequence RPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQLLRRNEQI.
88 kDa
100 ul
Golgi Apparatus Markers
Primary
2800
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:1000
NP_002068
gap junction protein, alpha 4, 37kD, golgi autoantigen, golgin subfamily a, 1, golgin A1, Golgin subfamily A member 1, Golgin-97, MGC33154
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit