GOLPH3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18180425UL

Catalog No. NB433670

Description

GOLPH3 Polyclonal specifically detects GOLPH3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GOLPH3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Coat protein GPP34, FLJ90675, Golgi phosphoprotein 3, golgi phosphoprotein 3 (coat-protein), golgi protein, golgi-associated protein, GOPP1, GPP34coat-protein, MIDASgolgi peripheral membrane protein 1, 34 kDa, Mitochondrial DNA absence factor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human GOLPH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GOLPH3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 64083
• Target Species: Human
• Isotype: IgG

For Research Use Only