Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GPAA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162435
Description
GPAA1 Polyclonal specifically detects GPAA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GPAA1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
anchor attachment protein 1 (Gaa1p, yeast) homolog, GAA1 protein homolog, GAA1glycophosphatidylinositol anchor attachment 1, glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast), GPAA1P anchor attachment protein 1 homolog, GPAA1P anchor attachment protein 1 homolog (yeast), GPI anchor attachment protein 1, GPI transamidase subunit, hGAA1glycosylphosphatidylinositol anchor attachment 1 protein | |
Rabbit | |
67 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
O43292 | |
GPAA1 | |
Synthetic peptides corresponding to GPAA1(glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)) The peptide sequence was selected from the C terminal of GPAA1. Peptide sequence LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
8733 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction